DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and zig-3

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_509336.1 Gene:zig-3 / 192088 WormBaseID:WBGene00006980 Length:251 Species:Caenorhabditis elegans


Alignment Length:209 Identity:44/209 - (21%)
Similarity:69/209 - (33%) Gaps:61/209 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 TALMGKSAYLSCRVRNLANKTVSWIR-------HRDIHIL---------TVGSYTYTSDQRFQAT 132
            |...|:|..|.|.|.:.....:.|.:       .:::::.         ||.|...||       
 Worm    54 TVSTGESVTLRCDVLSTPTGVIYWEKDGQRIQGDKELNVFEKVLNAMGPTVESGIITS------- 111

  Fly   133 HHQDTEDWTLQIKWAQKRDAGMYEC---------------QISTQPVRSYFVRLNVVVPTATILG 182
                    :.||..|.....|.|:|               .:..|.|:....|.:..|.|.:...
 Worm   112 --------SYQIPCANLHHIGSYKCVATNGHDTVESSAKISVEGQTVKCKSTRRSAPVITMSTES 168

  Fly   183 GPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNA 247
            ..:|. |..:|  |.|..    :..|...|...::.|::||.|   ..:...||     |||:..
 Worm   169 RFELQ-DNAAT--LICRA----DRRANWNWMFEDKKIDFDSGR---YELLPSGD-----LLIRKI 218

  Fly   248 DLADSGKYSCAPSN 261
            ..:|.|.|.|...|
 Worm   219 QWSDMGSYFCIAHN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 21/120 (18%)
IG_like 80..175 CDD:214653 21/121 (17%)
IG_like 184..271 CDD:214653 21/78 (27%)
IGc2 191..262 CDD:197706 19/71 (27%)
zig-3NP_509336.1 I-set 45..145 CDD:254352 18/105 (17%)
Ig 61..142 CDD:143165 15/95 (16%)
IG_like 177..244 CDD:214653 19/70 (27%)
Ig <191..237 CDD:299845 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.