DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and zig-2

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:206 Identity:45/206 - (21%)
Similarity:77/206 - (37%) Gaps:45/206 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TPRNVTALMGKSAYLSCRVRNLANKTVSW------IRHRDI-----HILTVGSYTYTSDQRFQAT 132
            ||.:.....|:...|||........::.|      |:..:.     :||..|.  ..|:....::
 Worm    38 TPNDSNVTFGEKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYENILNDGK--QVSNAAMVSS 100

  Fly   133 HHQDTEDWTLQIKWAQKRDAGMYECQIST-----QPVRSYFVRLNVVVPTATILGGP--DLHVD- 189
            |:        :|..|..|::|.|:|.|..     :.|...||..|.........|.|  .:.|| 
 Worm   101 HY--------RIPCATARNSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCALNDNGAPFISMTVDF 157

  Fly   190 ----KGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLA 250
                ..:.:.|:|..:.:.|    ..|:..|:::..|..|   ..:...||     |:|:|...:
 Worm   158 RLEISNNAVALSCRSETATE----WSWHKGEQLLTNDGER---YQMFPSGD-----LIIRNISWS 210

  Fly   251 DSGKYSCAPSN 261
            |.|:|:|...|
 Worm   211 DMGEYNCTARN 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 24/110 (22%)
IG_like 80..175 CDD:214653 23/110 (21%)
IG_like 184..271 CDD:214653 20/85 (24%)
IGc2 191..262 CDD:197706 17/71 (24%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 21/105 (20%)
Ig 34..121 CDD:299845 20/92 (22%)
Ig <179..232 CDD:299845 14/51 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.