DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and ver-3

DIOPT Version :10

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_509836.1 Gene:ver-3 / 181289 WormBaseID:WBGene00006896 Length:1227 Species:Caenorhabditis elegans


Alignment Length:260 Identity:51/260 - (19%)
Similarity:81/260 - (31%) Gaps:96/260 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 DTEDWTL---------------------QIKWAQK------RD-----AGMYECQISTQPVRSYF 168
            |::||::                     :||...|      ||     .|.|.|.:..:......
 Worm   597 DSDDWSVSWRFENSKSSDISSIPTTTETEIKQYSKHLILNLRDVTTSFTGTYTCVVKNEDSEKLL 661

  Fly   169 -VRLNV-VVPTATILGGPD---LHVDKGSTINLTCTVKFSPEPPAYIFW-----YHHEEVINYDS 223
             ..::| .:...:|.||..   :.||......:.|.:..:| ||.|.::     |.|        
 Worm   662 ETSIDV
KAISKPSITGGNSNAVVIVDYDQYFEINCNMTGTP-PPVYQWFKDGNPYTH-------- 717

  Fly   224 SRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNA---DVASVRVHVLNVRAIISGEHPEA 285
                       |||..|.|.:..|...|.|::.|..:|.   .:.|:.|.|.|.        |: 
 Worm   718 -----------GDVDGSILRVSRARGEDDGEFHCLATNRAGDKLNSIEVQVNNA--------PK- 762

  Fly   286 MQTGSSGCQYNWLTIVLLLGLVLCYSSQQCSSAVPASLTSSL-----------------PLPSQL 333
               ||  ..:.|...:|||..::......|.......||...                 |||.::
 Worm   763 ---GS--LFFYWFLALLLLISIIAVFLLTCKLRASNRLTKQKDIALNTLYETMIKHQAGPLPEEM 822

  Fly   334  333
             Worm   823  822

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 FR1 79..96 CDD:409355
IG_like 80..175 CDD:214653 12/72 (17%)
Ig strand A' 83..85 CDD:409355
Ig strand B 89..97 CDD:409355
CDR1 97..104 CDD:409355
FR2 105..114 CDD:409355
Ig strand C 105..110 CDD:409355
CDR2 115..129 CDD:409355
Ig strand D 129..135 CDD:409355
FR3 130..159 CDD:409355 11/54 (20%)
Ig strand E 139..145 CDD:409355 2/26 (8%)
Ig strand F 153..160 CDD:409355 3/6 (50%)
IG_like 184..271 CDD:214653 21/97 (22%)
Ig strand B 194..198 CDD:409353 0/3 (0%)
Ig strand C 209..213 CDD:409353 1/8 (13%)
Ig strand E 240..244 CDD:409353 2/3 (67%)
Ig strand F 254..259 CDD:409353 1/4 (25%)
Ig strand G 268..271 CDD:409353 1/2 (50%)
ver-3NP_509836.1 IG_like 242..>313 CDD:214653
IG_like 578..667 CDD:214653 11/69 (16%)
Ig strand B 588..592 CDD:409353
Ig strand C 602..606 CDD:409353 0/3 (0%)
Ig strand E 633..637 CDD:409353 0/3 (0%)
Ig strand F 647..652 CDD:409353 2/4 (50%)
Ig_3 672..744 CDD:464046 21/91 (23%)
PTKc 851..1164 CDD:270623
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.