DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and igcm-2

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001362087.1 Gene:igcm-2 / 180913 WormBaseID:WBGene00020130 Length:802 Species:Caenorhabditis elegans


Alignment Length:350 Identity:68/350 - (19%)
Similarity:122/350 - (34%) Gaps:105/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TAPTAAYTHPKWMEPYFDPSTPRN-----VTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTV 118
            |..:.||.|      .|.|..|.:     .|...|::..:||.|  :||.|.:            
 Worm   289 TTSSTAYLH------VFYPPEPLSSHQPVQTVASGRNTTVSCDV--IANPTPT------------ 333

  Fly   119 GSYTYTSDQRF---QATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVV---PT 177
             |||::.:..:   ||:.|       :.|.:|:..|.|:|.||......:...|..:::|   |.
 Worm   334 -SYTWSKNGHYLPTQASSH-------IIISYAKPGDGGIYGCQADNIAGKGSIVETHLIVAEPPV 390

  Fly   178 ATILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFL 242
            .|:....::.|..|..:::.|.....|.|  .::|                  |.:|..:..|.|
 Worm   391 FTVAPPSEIKVRLGDQVSIPCQGFGDPMP--IVYW------------------IRDKKRINQSTL 435

  Fly   243 LIQNADLADSGKYSCAPSNA-DVASVRVHVLNVRAIISGEHPEAMQT------GSSGCQYNWLTI 300
            ..:..:..|.|.|.|..:|: :..|.||.:|     :....|:...:      .||..:.:|   
 Worm   436 TFKKVEHLDHGAYECVVANSVETISTRVMLL-----VEITKPQMASSIKFTCLNSSSMRISW--- 492

  Fly   301 VLLLGLVLCYSSQQCSSAVPASLTSSLPLPSQLPLPAAAAATTTATGES------------ASSE 353
                           :.........:..:.:|..:.....:..|:..|:            .|.|
 Worm   493 ---------------TPGYNGGFDQTFAVHAQNDVTLQWTSIKTSLNETILDHLEPFVSYRVSIE 542

  Fly   354 SVTAARASAATTTTTTATRKRCPAV 378
            ||.|    ..:|.:||..|:.|.::
 Worm   543 SVNA----KGSTNSTTYNRRSCTSL 563

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 23/102 (23%)
IG_like 80..175 CDD:214653 23/102 (23%)
IG_like 184..271 CDD:214653 18/87 (21%)
IGc2 191..262 CDD:197706 13/70 (19%)
igcm-2NP_001362087.1 IG_like 23..101 CDD:214653
Ig 124..200 CDD:386229
IG_like 214..298 CDD:214653 4/14 (29%)
Ig_3 309..371 CDD:372822 21/83 (25%)
Ig 389..467 CDD:386229 21/102 (21%)
FN3 476..548 CDD:238020 11/93 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.