DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and Ncam1

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_006510118.1 Gene:Ncam1 / 17967 MGIID:97281 Length:1162 Species:Mus musculus


Alignment Length:424 Identity:82/424 - (19%)
Similarity:123/424 - (29%) Gaps:166/424 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 NVTALMGKSAYLSCRVRNLANKTVSW---------------------------IRHRD------- 112
            |.||.:|:|..|.|........|:||                           ||:.|       
Mouse   222 NATANLGQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEY 286

  Fly   113 --------------IH--ILTVGSYTYTSDQRFQATHHQDT------------------------ 137
                          ||  :......||..:|.......|.|                        
Mouse   287 VCIAENKAGEQDASIHLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISS 351

  Fly   138 ---EDWT----------------------LQIKWAQKRDAGMYECQIST---QPVRSYFVRLNVV 174
               ..||                      |.:|..|..|||.|.|..|.   |..:|.::.    
Mouse   352 EEKASWTRPEKQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLE---- 412

  Fly   175 VPTATILGGP-DLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVI---NYDSSRGGVSVITEKG 235
            |..|..|.|| .::..:|:.:|:||.| |: .|.|.|.|:...:::   ||       |.|....
Mouse   413 V
QYAPKLQGPVAVYTWEGNQVNITCEV-FA-YPSATISWFRDGQLLPSSNY-------SNIKIYN 468

  Fly   236 DVTTSFLLIQNADLADSGKYSCAPSN-------------ADVASV----RVHVLNVRAIISGEHP 283
            ..:.|:|.:......|.|.|:|...|             ||..|.    ||...:..|.:..:.|
Mouse   469 TPSASYLEVTPDSENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDRVEPYSSTAQVQFDEP 533

  Fly   284 EA-------------MQTGSSGCQYNWLT--------IVLLLGL---------VLCYSSQQCSSA 318
            ||             ...|.....:.|..        ||.::||         :...:.:.....
Mouse   534 EATGGVPILKYKAEWKSLGEESWHFKWYDAKEANMEGIVTIMGLKPETRYSVRLAALNGKGLGEI 598

  Fly   319 VPASLTSSLPLPSQLPLPAAAAATTTATGESASS 352
            ..|:...:.|:.|..||..|.::|.......|::
Mouse   599 SAATEFKTQPVHSPPPLAPANSSTLVPLSPRATT 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 33/193 (17%)
IG_like 80..175 CDD:214653 33/194 (17%)
IG_like 184..271 CDD:214653 27/107 (25%)
IGc2 191..262 CDD:197706 21/86 (24%)
Ncam1XP_006510118.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652
Ig3_NCAM-1_like 211..308 CDD:143207 15/85 (18%)
Ig_NCAM-1 307..413 CDD:143277 18/109 (17%)
Ig_3 417..494 CDD:372822 23/85 (27%)
FN3 509..606 CDD:238020 15/96 (16%)
fn3 649..731 CDD:365830
PHA03247 <905..1140 CDD:223021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.