DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and zig-8

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:228 Identity:62/228 - (27%)
Similarity:97/228 - (42%) Gaps:29/228 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DPS-TPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTED 139
            :|| |..||.|  ...|||.|.|...|...::|.|..|..:||.|:.|:|.|.|:|.: .:....
 Worm    39 NPSQTIVNVVA--ENPAYLHCSVPPDAEHEIAWTRVSDGALLTAGNRTFTRDPRWQVS-KKSANI 100

  Fly   140 WTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGPDLHVDK---------GSTIN 195
            |.|.::.|:::|:|.|.|:|:.:....|.|.|.|:.|.   |..|.....|         |..:.
 Worm   101 WVLNLRRAEQQDSGCYLCEINDKHNTVYAVYLKVLEPP---LPSPSSLQKKSTKLMANMSGDEVV 162

  Fly   196 LTCTVKFS--PEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCA 258
            |.|||..:  .|....:.|......||::.:...:..:.....|....:.|:.|.:.|.|.|:|.
 Worm   163 LNCTVTSTDKDEEVLDVVWTRDGNTINFNDTEKYILKVKRDAGVVIETMRIRKATMEDDGNYACE 227

  Fly   259 PSNADVASVRVHVLNVRAIISGEHPEAMQTGSS 291
            .|....:.: ||:....|          ||.:|
 Worm   228 HSQQKASQI-VHINKAEA----------QTSNS 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 32/94 (34%)
IG_like 80..175 CDD:214653 32/94 (34%)
IG_like 184..271 CDD:214653 20/97 (21%)
IGc2 191..262 CDD:197706 17/72 (24%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 26/79 (33%)
Ig 55..129 CDD:143165 23/74 (31%)
ig 158..229 CDD:278476 16/70 (23%)
IG_like 158..227 CDD:214653 15/68 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 58 1.000 Domainoid score I7153
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.