DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and rig-5

DIOPT Version :10

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:52 Identity:15/52 - (28%)
Similarity:24/52 - (46%) Gaps:6/52 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LLYKKKNQIVKGNRIL-ISVTFLGSAGPI-----RFVANEGDLVASVIDTAL 47
            ||..:|..||..|..| |:..:....||:     :|||:.......::||.:
 Worm    28 LLASEKKLIVGHNCFLDIAHVYSKFVGPLPSTAEKFVASINSHFPYIVDTKI 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 FR1 79..96 CDD:409355
IG_like 80..175 CDD:214653
Ig strand A' 83..85 CDD:409355
Ig strand B 89..97 CDD:409355
CDR1 97..104 CDD:409355
FR2 105..114 CDD:409355
Ig strand C 105..110 CDD:409355
CDR2 115..129 CDD:409355
Ig strand D 129..135 CDD:409355
FR3 130..159 CDD:409355
Ig strand E 139..145 CDD:409355
Ig strand F 153..160 CDD:409355
IG_like 184..271 CDD:214653
Ig strand B 194..198 CDD:409353
Ig strand C 209..213 CDD:409353
Ig strand E 240..244 CDD:409353
Ig strand F 254..259 CDD:409353
Ig strand G 268..271 CDD:409353
rig-5NP_001251131.1 IG_like 92..189 CDD:214653
Ig strand B 102..106 CDD:409353
Ig strand C 118..122 CDD:409353
Ig strand E 154..158 CDD:409353
Ig strand F 168..173 CDD:409353
Ig_3 190..270 CDD:464046
Ig_3 287..369 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.