DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and rig-5

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001251131.1 Gene:rig-5 / 172791 WormBaseID:WBGene00004372 Length:482 Species:Caenorhabditis elegans


Alignment Length:208 Identity:52/208 - (25%)
Similarity:84/208 - (40%) Gaps:40/208 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWI----------------RHRDIHILTVGSY 121
            |.....:..:..||:|:....:|.|.:|.:..|:::                |.|:         
 Worm    84 PTIQQPSMSSAVALLGQDVDFTCIVNDLGSHMVAFVKADSPPRLLSFDEKVFRRRN--------- 139

  Fly   122 TYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPTATILGGP-D 185
            .|....|....|:    :|.|.||..|:.|.|.|.|||:|:|:......|:|.||.......| .
 Worm   140 KYELKPRIGDLHN----EWVLTIKNVQESDRGNYSCQINTEPITLSTGELDVKVPPVVSRSTPAA 200

  Fly   186 LHVDKGSTINLTCTVKFSPEPPAYIFWYHHE-EVINYDSSRG-GVSVITEKGDVTTSFLLIQNAD 248
            :.|.:|:.::|||....:|.|.  :.|...: ::|.|:.:.| |.||.  .|.|    |.:....
 Worm   201 VEVREGNNVSLTCKADGNPTPT--VIWRRQDRQIIRYNGATGFGASVF--HGPV----LHLTKVS 257

  Fly   249 LADSGKYSCAPSN 261
            .....:|.|..||
 Worm   258 RKHMSEYLCVASN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 26/110 (24%)
IG_like 80..175 CDD:214653 27/110 (25%)
IG_like 184..271 CDD:214653 22/81 (27%)
IGc2 191..262 CDD:197706 20/73 (27%)
rig-5NP_001251131.1 IG_like 92..189 CDD:214653 27/109 (25%)
Ig_3 191..270 CDD:372822 20/86 (23%)
IG 294..380 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.