Sequence 1: | NP_001287018.1 | Gene: | dpr6 / 50296 | FlyBaseID: | FBgn0040823 | Length: | 396 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074739.2 | Gene: | Dscaml1 / 114873 | MGIID: | 2150309 | Length: | 2053 | Species: | Mus musculus |
Alignment Length: | 337 | Identity: | 76/337 - (22%) |
---|---|---|---|
Similarity: | 123/337 - (36%) | Gaps: | 93/337 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 81 RNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSYTYTSDQRFQATHHQDTEDWTLQIK 145
Fly 146 WAQK-RDAGMYECQISTQPVRSYFVRLNVVV-----------PTATILGGPDLHVDKGSTINLTC 198
Fly 199 TVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNADLADSGKYSCAPSNAD 263
Fly 264 VASVRVHVLNVRA----IISGEH--------------------PEAMQTGSSGC----QYNWLTI 300
Fly 301 V----------LL--------LGLVLCYSSQQCSSAVPASLTSSLPLPSQLPLPAAAAATTTATG 347
Fly 348 ESASSESVTAAR 359 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr6 | NP_001287018.1 | V-set | 79..174 | CDD:284989 | 25/93 (27%) |
IG_like | 80..175 | CDD:214653 | 26/94 (28%) | ||
IG_like | 184..271 | CDD:214653 | 23/86 (27%) | ||
IGc2 | 191..262 | CDD:197706 | 20/70 (29%) | ||
Dscaml1 | NP_001074739.2 | IGc2 | 43..110 | CDD:197706 | |
Ig | 125..218 | CDD:353325 | |||
I-set | 226..311 | CDD:336764 | |||
Ig_3 | 317..389 | CDD:339005 | |||
Ig | 408..498 | CDD:353325 | |||
IGc2 | 519..577 | CDD:197706 | 18/71 (25%) | ||
Ig | 615..681 | CDD:319273 | 21/72 (29%) | ||
Ig_DSCAM | 707..785 | CDD:143211 | 14/81 (17%) | ||
Ig | 803..891 | CDD:353325 | 3/11 (27%) | ||
FN3 | 887..981 | CDD:238020 | |||
FN3 | 988..1085 | CDD:238020 | |||
FN3 | 1093..1186 | CDD:238020 | |||
FN3 | 1191..1282 | CDD:238020 | |||
Ig | 1307..1377 | CDD:319273 | |||
FN3 | 1384..1474 | CDD:238020 | |||
FN3 | 1488..1560 | CDD:238020 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1716..1741 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1773..1803 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1840..1862 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1974..2053 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |