DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and kirrel1b

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:273 Identity:68/273 - (24%)
Similarity:115/273 - (42%) Gaps:72/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 HPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRN---------------LANKTVSWIRHRDIHIL 116
            |..:..|.|. ..|.:.:.::|:...|||.|.|               :.....:|.|:|.:.|:
Zfish    19 HRVFSGPRFS-QEPADQSVVIGERVVLSCVVFNYTGIVQWTKDGLALGIGEDLRAWPRYRVLRIM 82

  Fly   117 TVGSYTYTSDQRFQATHHQDTEDWTLQIKWAQKRDAGMYECQISTQPVRSYFVRLNVVVPT--AT 179
            .||.|                   .|:|..|...|..:||||.:...:||...:|.|::|.  ..
Zfish    83 DVGQY-------------------NLEITSADLTDDSLYECQATEAALRSRRAKLTVLIPPDGPV 128

  Fly   180 ILGGPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTT-SFLL 243
            |.|.|::.:..|::.|||| |....:|.:.|.||  ::.|..:.:.....|::::..||| |||.
Zfish   129 IEGSPEILLTAGTSFNLTC-VSRGAKPMSTIEWY--KDGIIVEGAHTSTEVLSDRKRVTTKSFLE 190

  Fly   244 IQNADLADSGK-YSCAPSN-------ADVASVRVH-----VLNV--RAIISGEHPEAMQTGSSGC 293
            ||..| .|:|: ::|..||       ....::.:|     :|::  |:::.||..:..      |
Zfish   191 IQPMD-TDTGRNFTCVASNLAAPLGKRSTVTLNIHHPPTVILSIEPRSVLEGERVKFT------C 248

  Fly   294 Q---------YNW 297
            |         |.|
Zfish   249 QATANPPIMGYRW 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 25/109 (23%)
IG_like 80..175 CDD:214653 26/109 (24%)
IG_like 184..271 CDD:214653 28/100 (28%)
IGc2 191..262 CDD:197706 26/79 (33%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.