DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr6 and negr1

DIOPT Version :9

Sequence 1:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_031755650.1 Gene:negr1 / 100127726 XenbaseID:XB-GENE-987949 Length:388 Species:Xenopus tropicalis


Alignment Length:372 Identity:87/372 - (23%)
Similarity:138/372 - (37%) Gaps:79/372 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LLPTA-PTAAYTHPKWMEPYFDPSTPRNVTALMGKSAYLSCRVRNLANKTVSWIRHRDIHILTVG 119
            |||:. |.......:|  |..|     |:....|::|.|.|.:...|:|. :|:....  |:..|
 Frog    28 LLPSCLPAGQSMDFQW--PAVD-----NLVVRQGETAMLRCFLEEGASKG-AWLNRSS--IIFAG 82

  Fly   120 SYTYTSDQRFQ-ATHHQDTEDWTLQIKWAQKRDAGMYECQISTQ-PVRSYFVRLNVVVPTATILG 182
            ...::.|.|.. ||  ...::::|:|:.....|.|.|.|.:.|: ..|:..|.|.|.|.......
 Frog    83 GDKWSVDPRVSIAT--SSKQEYSLRIQKVDVSDDGPYTCSVQTEHSPRTLQVHLTVHVSPKIYDI 145

  Fly   183 GPDLHVDKGSTINLTCTVKFSPEPPAYIFWYHHEEVINYDSSRGGVSVITEKGDVTTSFLLIQNA 247
            ..|:.|::|:.::|.|.....|||.  |.|.|    |:..:.:.|          :..:|.|...
 Frog   146 SSDMTVNEGTNVSLICLATGKPEPS--ISWRH----ISPSAKQFG----------SGQYLDIYGI 194

  Fly   248 DLADSGKYSCAPSN----ADVASVRVHVLNVRAIISGEHPEAMQTGSSG---CQ----------- 294
            ....:|.|.|:..|    .||..|:|.| |....|....|..:..|.:|   |:           
 Frog   195 TRDQAGDYECSAENDVSFPDVKKVKVTV-NFAPTILEITPTGVSLGRTGLIRCETAAVPAPVFEW 258

  Fly   295 ------------------YNWLTIVLLLGLVLCYSSQQCSSAVPASLTSSLPLP-SQLPLPAAAA 340
                              ||..:|:.:..:...:.......||....||:..|| :|:..|    
 Frog   259 YKGEKKLTNGQRGIRIQNYNTRSILTVSNVTEEHFGNYTCVAVNKLGTSNASLPLNQIIEP---- 319

  Fly   341 ATTTATGESASSESVTAARAS------AATTTTTTATRKRCPAVKSC 381
            :||:....||.......||:|      ||.:|.......|...:.||
 Frog   320 STTSPVTSSAKYSVKHYARSSSDKPHYAAPSTAQYGITGRAEILFSC 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr6NP_001287018.1 V-set 79..174 CDD:284989 24/96 (25%)
IG_like 80..175 CDD:214653 25/96 (26%)
IG_like 184..271 CDD:214653 23/90 (26%)
IGc2 191..262 CDD:197706 17/74 (23%)
negr1XP_031755650.1 Ig 44..136 CDD:416386 26/101 (26%)
FR1 44..62 CDD:409353 6/22 (27%)
Ig strand A' 47..53 CDD:409353 2/10 (20%)
Ig strand B 55..63 CDD:409353 3/7 (43%)
CDR1 63..68 CDD:409353 0/4 (0%)
FR2 69..75 CDD:409353 2/6 (33%)
Ig strand C 69..74 CDD:409353 2/5 (40%)
CDR2 76..87 CDD:409353 2/12 (17%)
Ig strand C' 78..82 CDD:409353 1/3 (33%)
Ig strand C' 84..87 CDD:409353 0/2 (0%)
FR3 88..122 CDD:409353 10/35 (29%)
Ig strand D 91..98 CDD:409353 3/8 (38%)
Ig strand E 101..107 CDD:409353 1/5 (20%)
Ig strand F 114..122 CDD:409353 3/7 (43%)
CDR3 123..127 CDD:409353 1/3 (33%)
Ig strand G 127..136 CDD:409353 3/8 (38%)
FR4 129..136 CDD:409353 2/6 (33%)
Ig_3 140..208 CDD:404760 18/83 (22%)
Ig strand A' 146..151 CDD:409353 1/4 (25%)
Ig strand B 157..164 CDD:409353 2/6 (33%)
Ig strand C 170..175 CDD:409353 2/6 (33%)
Ig strand C' 177..179 CDD:409353 0/1 (0%)
Ig strand E 187..193 CDD:409353 2/5 (40%)
Ig strand F 200..207 CDD:409353 3/6 (50%)
Ig strand G 214..222 CDD:409353 4/7 (57%)
Ig_3 226..302 CDD:404760 9/75 (12%)
putative Ig strand A 226..232 CDD:409353 1/5 (20%)
Ig strand B 242..246 CDD:409353 1/3 (33%)
Ig strand C 255..259 CDD:409353 0/3 (0%)
Ig strand E 281..285 CDD:409353 1/3 (33%)
Ig strand F 295..300 CDD:409353 0/4 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.