DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY2 and TkR86C

DIOPT Version :9

Sequence 1:NP_002555.4 Gene:P2RY2 / 5029 HGNCID:8541 Length:377 Species:Homo sapiens
Sequence 2:NP_001097741.1 Gene:TkR86C / 41286 FlyBaseID:FBgn0004841 Length:555 Species:Drosophila melanogaster


Alignment Length:314 Identity:68/314 - (21%)
Similarity:137/314 - (43%) Gaps:37/314 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    25 CRFNEDFKYVLLP--------VSYGVVCVPGLCLNAVALYIFLCRLKTWNASTTYMFHLAVSDAL 81
            |.|....:...||        :.:|::....:..|.:.|:|..........:..::.:|:::|.|
  Fly    67 CLFPSPTRPYELPWEQKTIWAIIFGLMMFVAIAGNGIVLWIVTGHRSMRTVTNYFLLNLSIADLL 131

Human    82 YAASLPLLVYYYARGDHWPFSTVLCKLVRFLFYTNLYCSILFLTCISVHRCLGVLRPLRSLRWGR 146
            .::...:..:.:.....|||.::.|.:..|:....:..|:..|..||..|.:.::.||:  |...
  Fly   132 MSSLNCVFNFIFMLNSDWPFGSIYCTINNFVANVTVSTSVFTLVAISFDRYIAIVHPLK--RRTS 194

Human   147 ARYARRVAGAVWVLVLACQAPVLYFVTTSAR-----GGRVTCH----DTSAPELFSRFVAYSSVM 202
            .|..|.:...:|.|.....||.|.:.:...:     ..|..|.    |...|...:.: ||:.::
  Fly   195 RRKVRIILVLIWALSCVLSAPCLLYSSIMTKHYYNGKSRTVCFMMWPDGRYPTSMADY-AYNLII 258

Human   203 LGLLFAVPFAVILVCYVLMARRLLKPAYGTSG---------GLPRAKRKSVRTIAVVLAVFALCF 258
            |.|.:.:|..|:|:||.||.|.|    :|:..         ...::|||.||....::::||:|:
  Fly   259 LVLTYGIPMIVMLICYSLMGRVL----WGSRSIGENTDRQMESMKSKRKVVRMFIAIVSIFAICW 319

Human   259 LPFHVTRTLYYSFRSLDLSCHTLNAINMAYKVTRPLASANSCLDPVLYFLAGQR 312
            ||:|    |::.:...:....:...:...|.....||.:|:.::|::|:...:|
  Fly   320 LPYH----LFFIYAYHNNQVASTKYVQHMYLGFYWLAMSNAMVNPLIYYWMNKR 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY2NP_002555.4 7tmA_P2Y2 34..317 CDD:320495 66/305 (22%)
TM helix 1 34..61 CDD:320495 6/34 (18%)
TM helix 2 68..93 CDD:320495 3/24 (13%)
TM helix 3 106..136 CDD:320495 7/29 (24%)
TM helix 4 148..170 CDD:320495 6/21 (29%)
TM helix 5 195..224 CDD:320495 11/28 (39%)
TM helix 6 238..268 CDD:320495 11/29 (38%)
TM helix 7 285..310 CDD:320495 6/24 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..377
TkR86CNP_001097741.1 7tm_4 92..376 CDD:304433 63/289 (22%)
7tm_1 100..363 CDD:278431 61/273 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.