DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BobA and CG13465

DIOPT Version :9

Sequence 1:NP_525087.2 Gene:BobA / 50281 FlyBaseID:FBgn0040487 Length:78 Species:Drosophila melanogaster
Sequence 2:NP_525000.1 Gene:CG13465 / 50282 FlyBaseID:FBgn0040809 Length:78 Species:Drosophila melanogaster


Alignment Length:78 Identity:76/78 - (97%)
Similarity:77/78 - (98%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFTETALVSNFNGVTEKKSLTGASTNLKKLLKTIKKVFKNSKPSKEIPIPNIIYSCNTEEEHQNW 65
            ||.||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MFAETALVSNFNGVTEKKSLTGASTNLKKLLKTIKKVFKNSKPSKEIPIPNIIYSCNTEEEHQNW 65

  Fly    66 LNEQLEAMAIHLH 78
            |||:|||||||||
  Fly    66 LNEKLEAMAIHLH 78



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450792
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016672
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.