DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY1 and 5-HT7

DIOPT Version :9

Sequence 1:NP_002554.1 Gene:P2RY1 / 5028 HGNCID:8539 Length:373 Species:Homo sapiens
Sequence 2:NP_001263131.1 Gene:5-HT7 / 43669 FlyBaseID:FBgn0004573 Length:564 Species:Drosophila melanogaster


Alignment Length:435 Identity:86/435 - (19%)
Similarity:150/435 - (34%) Gaps:143/435 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    11 NGTDAAFLAGPGSSWGNSTVASTAAVS-SSFKCALTKTGFQFYYLP-------AVYILVFIIG-F 66
            |.:..|.::..|.:..|...::|..|. |.....|.:.....:.||       ::.:|:.|:| .
  Fly   113 NSSPIAIVSYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLTSIFVSIVLLIVILGTV 177

Human    67 LGN---SVAIWMFVFHMKPWSGISVYMFNLALADF-LYVLTLP-ALIFYYFNKTDWIFGDAMCKL 126
            :||   .:|:.|.....:|.:.:.|   :|||:|. :.:|.:| ||::....|  |.||..:|.:
  Fly   178 VGNVLVCIAVCMVRKLRRPCNYLLV---SLALSDLCVALLVMPMALLYEVLEK--WNFGPLLCDI 237

Human   127 QRFIFHVNLYGSILFLTCISAHRYSGVVYPLK-SLGRLKKKNAICISVLVWLIVV-VAISPILFY 189
            ......:....|||.|..||..||..:..||: .:.|..::..:|:.: |||... :::.|:|..
  Fly   238 WVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGI-VWLAAACISLPPLLIL 301

Human   190 SGTGVRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRA----------- 243
            ......:.....|  |....     |.|.:..|:..|.:||.::|..|..|.||           
  Fly   302 GNEHEDEEGQPIC--TVCQN-----FAYQIYATLGSFYIPLSVMLFVYYQIFRAARRIVLEEKRA 359

Human   244 -------------------------------------------LIYK------------------ 247
                                                       |.|.                  
  Fly   360 QTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSG 424

Human   248 -------DLDNSPLRRKSIYLVI----------IVLTVFAVSYIPFHVMKTMNLRARLDFQTPAM 295
                   .|..||..:|..:.:.          |:::.|.|.::||.::..:             
  Fly   425 GGVSGSTGLLGSPHHKKLRFQLAKEKKASTTLGIIMSAFTVCWLPFFILALI------------- 476

Human   296 CAFNDRVYATYQVTRGLASL-------NSCVDPILYFLAGDTFRR 333
                 |.:.|..|...|:||       ||.::||:|......||:
  Fly   477 -----RPFETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRK 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY1NP_002554.1 7tmA_P2Y1 52..335 CDD:320499 78/393 (20%)
TM helix 1 52..79 CDD:320499 9/37 (24%)
TM helix 2 86..111 CDD:320499 9/26 (35%)
TM helix 3 124..154 CDD:320499 9/29 (31%)
TM helix 4 166..188 CDD:320499 5/22 (23%)
TM helix 5 214..243 CDD:320499 9/28 (32%)
TM helix 6 253..283 CDD:320499 7/39 (18%)
TM helix 7 303..328 CDD:320499 10/31 (32%)
5-HT7NP_001263131.1 7tm_4 173..>342 CDD:304433 47/181 (26%)
7tm_1 179..507 CDD:278431 70/358 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.