DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY1 and TyrRII

DIOPT Version :9

Sequence 1:NP_002554.1 Gene:P2RY1 / 5028 HGNCID:8539 Length:373 Species:Homo sapiens
Sequence 2:NP_001262682.1 Gene:TyrRII / 42135 FlyBaseID:FBgn0038541 Length:586 Species:Drosophila melanogaster


Alignment Length:241 Identity:58/241 - (24%)
Similarity:105/241 - (43%) Gaps:28/241 - (11%)


- Green bases have known domain annotations that are detailed below.


Human    11 NGTDAAFL-----AGPGSSWGNSTVASTAAVSS-----SFKCALTKTGFQFYYLPAVYILVFIIG 65
            |.:|...|     |.||..     |.:|.|.:.     |....|....:......||::::.::.
  Fly    29 NSSDGTLLLIQTSAAPGGD-----VMATGAGAGKLGVPSMNSYLVSMAWPKSLAVAVFLVIILVT 88

Human    66 FLGNSVAIWMFVFHMKPWSGISVYMFNLALADFLY-VLTLPALIFYYFNKTDWIFGDAMCKLQRF 129
            .:||::.|...:...:..:..:.::.|||:.|:|. ...:|..:..|...| |.||..:|.:...
  Fly    89 VVGNTLVILAVLTTRRLRTVTNCFVMNLAITDWLVGTCVMPPSVVLYITGT-WRFGWILCDIWIS 152

Human   130 IFHVNLYGSILFLTCISAHRYSGVVYPLK-SLGRLKKKNAICISVLVWLIVV-VAISPILFYSGT 192
            :..:...||||.|..||..||..|..||. |..|..|:.|:.:.::||:..: :...|.|.:...
  Fly   153 LDILLCSGSILSLCAISLDRYLAVTQPLTYSKKRRSKRLALLMILVVWITALSITCPPYLGWYEV 217

Human   193 GVRKNKTITC-YDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCY 237
            |..:.:.:.| |:..     :.|.::|   .:..|.:||.::|..|
  Fly   218 GRHQAEFVDCRYNQN-----KGYVVFS---AMGSFFIPLTVMLYVY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY1NP_002554.1 7tmA_P2Y1 52..335 CDD:320499 47/190 (25%)
TM helix 1 52..79 CDD:320499 5/26 (19%)
TM helix 2 86..111 CDD:320499 6/25 (24%)
TM helix 3 124..154 CDD:320499 10/29 (34%)
TM helix 4 166..188 CDD:320499 4/22 (18%)
TM helix 5 214..243 CDD:320499 7/24 (29%)
TM helix 6 253..283 CDD:320499
TM helix 7 303..328 CDD:320499
TyrRIINP_001262682.1 7tm_4 82..>212 CDD:304433 34/130 (26%)
7tm_1 91..>277 CDD:278431 45/174 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.