DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY1 and AstC-R1

DIOPT Version :9

Sequence 1:NP_002554.1 Gene:P2RY1 / 5028 HGNCID:8539 Length:373 Species:Homo sapiens
Sequence 2:NP_649040.2 Gene:AstC-R1 / 40020 FlyBaseID:FBgn0036790 Length:483 Species:Drosophila melanogaster


Alignment Length:382 Identity:91/382 - (23%)
Similarity:158/382 - (41%) Gaps:29/382 - (7%)


- Green bases have known domain annotations that are detailed below.


Human    11 NGTDAAFLAGPGSSW--GNSTVASTAAVSSS-----FKCALTKTGFQFYYLPAVYILVFIIGFLG 68
            |..::.:.......|  |:||:....::..:     ..|..|:..|...:...:|..|.|||..|
  Fly    30 NTNESLYTTELNHRWISGSSTIQPEESLYGTDLPTYQHCIATRNSFADLFTVVLYGFVCIIGLFG 94

Human    69 NSVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHV 133
            |::.|::.:...|..:..::|:.|||:||..:::.:|.|: |......|.||:.|||.......:
  Fly    95 NTLVIYVVLRFSKMQTVTNIYILNLAVADECFLIGIPFLL-YTMRICSWRFGEFMCKAYMVSTSI 158

Human   134 NLYGSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLIVVVAISPILFYSGT-----G 193
            ..:.|.:||..:||.||..|.:|:.|........|..:|.:.|....|.:.|::.|:.|     |
  Fly   159 TSFTSSIFLLIMSADRYIAVCHPISSPRYRTLHIAKVVSAIAWSTSAVLMLPVILYASTVEQEDG 223

Human   194 VRKNKTITCYDTTSDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRALI-------YKDLDN 251
            :..:..|...|........::.:|   |....|..||..||..|.|::|.|.       .|..:.
  Fly   224 INYSCNIMWPDAYKKHSGTTFILY---TFFLGFATPLCFILSFYYLVIRKLRSVGPKPGTKSKEK 285

Human   252 SPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLN 316
            ....||...||:.|::|:.:.::|..:.     :..|....||....:......:.:...|...|
  Fly   286 RRAHRKVTRLVLTVISVYILCWLPHWIS-----QVALIHSNPAQRDLSRLEILIFLLLGALVYSN 345

Human   317 SCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL 373
            |.|:||||....:.||:...:|. ....:.:.|.|.:.|..........|:.|...|
  Fly   346 SAVNPILYAFLSENFRKSFFKAF-TCMNKQDINAQLQLEPSVFTKQGSKKRGGSKRL 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY1NP_002554.1 7tmA_P2Y1 52..335 CDD:320499 76/294 (26%)
TM helix 1 52..79 CDD:320499 8/26 (31%)
TM helix 2 86..111 CDD:320499 8/24 (33%)
TM helix 3 124..154 CDD:320499 9/29 (31%)
TM helix 4 166..188 CDD:320499 5/21 (24%)
TM helix 5 214..243 CDD:320499 9/28 (32%)
TM helix 6 253..283 CDD:320499 7/29 (24%)
TM helix 7 303..328 CDD:320499 8/24 (33%)
AstC-R1NP_649040.2 7tm_4 88..368 CDD:304433 74/288 (26%)
7tm_1 94..353 CDD:278431 67/267 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.