DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY1 and Octbeta3R

DIOPT Version :9

Sequence 1:NP_002554.1 Gene:P2RY1 / 5028 HGNCID:8539 Length:373 Species:Homo sapiens
Sequence 2:NP_001034048.2 Gene:Octbeta3R / 3885573 FlyBaseID:FBgn0250910 Length:1256 Species:Drosophila melanogaster


Alignment Length:341 Identity:74/341 - (21%)
Similarity:136/341 - (39%) Gaps:78/341 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    13 TDAAF----LAGPGSSWGNSTVA--STAAVSSSF--KCALTKTGFQFYYLPAVYILVFIIGFLGN 69
            :|:.|    ..||..:...|.:|  :.|.:..|:  ...|...||       ::..:.:...|||
  Fly   100 SDSTFELLSTVGPNITANGSDIAVDNQAELEESWLDLSLLLLKGF-------IFSSIILAAVLGN 157

Human    70 SVAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKT------DWIFGDAMCKLQR 128
            ::.|.....:.|.....:.::.:||:||.|.     ||....||.:      .|:||..||.:..
  Fly   158 ALVIISVQRNRKLRVITNYFVVSLAMADMLV-----ALCAMTFNASVELSGGKWMFGPFMCNVYN 217

Human   129 FIFHVNLY---GSILFLTCISAHRYSGVVYPLKSLGRLKKKNAICISVLVWLI-VVVAISPIL-- 187
               .:::|   .|||.|.|||..||..:|.||:....:..|....:...||:: .:::.:||.  
  Fly   218 ---SLDVYFSTASILHLCCISVDRYYAIVRPLEYPLNMTHKTVCFMLANVWILPALISFTPIFLG 279

Human   188 FYSGTGVRKNKTITCYDTTSDEYLR---------SYFI---YSMCTTVAMFCVPLVLILGCYGLI 240
            :|                |::|:||         |:.:   |::.::...|.:|.:::|..|..|
  Fly   280 WY----------------TTEEHLREISLHPDQCSFVVNKAYALISSSVSFWIPGIVMLVMYWRI 328

Human   241 VRALIYKDLDNSPLRRKSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQTPAMCAFNDRVYAT 305
            .:..|.:   ...|.|.|..:::..:          |:..|.. ...|.:..|:.|..| ...|.
  Fly   329 FKEAIRQ---RKALSRTSSNILLNSV----------HMGHTQQ-PTSLSYLHPSDCDLN-ATSAR 378

Human   306 YQVTRGLASLNSCVDP 321
            .:....|::|...:.|
  Fly   379 EETHSALSNLEDMLQP 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY1NP_002554.1 7tmA_P2Y1 52..335 CDD:320499 63/294 (21%)
TM helix 1 52..79 CDD:320499 4/26 (15%)
TM helix 2 86..111 CDD:320499 7/24 (29%)
TM helix 3 124..154 CDD:320499 11/32 (34%)
TM helix 4 166..188 CDD:320499 5/24 (21%)
TM helix 5 214..243 CDD:320499 6/31 (19%)
TM helix 6 253..283 CDD:320499 5/29 (17%)
TM helix 7 303..328 CDD:320499 4/19 (21%)
Octbeta3RNP_001034048.2 7tm_4 146..>346 CDD:304433 53/226 (23%)
7tm_1 156..>344 CDD:278431 51/214 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.