DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P2RY1 and AkhR

DIOPT Version :9

Sequence 1:NP_002554.1 Gene:P2RY1 / 5028 HGNCID:8539 Length:373 Species:Homo sapiens
Sequence 2:NP_995639.1 Gene:AkhR / 33942 FlyBaseID:FBgn0025595 Length:455 Species:Drosophila melanogaster


Alignment Length:385 Identity:94/385 - (24%)
Similarity:160/385 - (41%) Gaps:81/385 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    23 SSWGNSTVASTAAVSSSFKCALTKTGFQFYYLPAVYILVFIIGFLGNSVAIWMFV-FHMKPWSGI 86
            |:|.|  |..|.......|..:...|.:...  .||.::|:|..:|||..:::.. ..::....|
  Fly    14 SNWSN--VNDTNGTIHLTKDMVFNDGHRLSI--TVYSILFVISTIGNSTVLYLLTKRRLRGPLRI 74

Human    87 SVYMFNLALADFLYVLTLPALIFYYFNKTDWIFGDAMCKLQRFIFHVNLYGSILFLTCISAHRYS 151
            .:.:.:||:||.:..|.|..:...:.....|:..|.||:|..|.....||.|...:.|||..||.
  Fly    75 DIMLMHLAIADLMVTLLLMPMEIVWAWTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYF 139

Human   152 GVVYPLK---SLGRLKKKNAICISVLVWLIVVVAISP--ILFY-----SGTGVRKNKTITCYDTT 206
            .::.|||   :.||:       :....||..||...|  .||:     :.||..:......:.:.
  Fly   140 AILKPLKRSYNRGRI-------MLACAWLGSVVCSIPQAFLFHLEEHPAVTGYFQCVIFNSFRSD 197

Human   207 SDEYLRSYFIYSMCTTVAMFCVPLVLILGCYGLIVRAL------IYKDLDNSPLRR--------- 256
            .||.|  |...|||   :|:..||::.:.|||.|...:      :.||:.....||         
  Fly   198 FDEKL--YQAASMC---SMYAFPLIMFIYCYGAIYLEIYRKSQRVLKDVIAERFRRSNDDVLSRA 257

Human   257 --KSIYLVIIVLTVFAVSYIPFHVMKTMNLRARLDFQT---------PAMCAFNDRVYATYQVTR 310
              :::.:.|.::.||.:.:.|::   |:::...||..:         .|:..|            
  Fly   258 KKRTLKMTITIVIVFIICWTPYY---TISMWYWLDKHSAGKINPLLRKALFIF------------ 307

Human   311 GLASLNSCVDPILYFLAGDTFRRRL--------SRATRKASRRSEANLQSKSEDMTLNIL 362
              ||.|||::|::|.|.  ..|.|:        :|.|..::|...:| |...:.:|.|.|
  Fly   308 --ASTNSCMNPLVYGLY--NIRGRMNNNNPSVNNRHTSLSNRLDSSN-QLMQKQLTNNSL 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P2RY1NP_002554.1 7tmA_P2Y1 52..335 CDD:320499 78/319 (24%)
TM helix 1 52..79 CDD:320499 7/27 (26%)
TM helix 2 86..111 CDD:320499 7/24 (29%)
TM helix 3 124..154 CDD:320499 11/29 (38%)
TM helix 4 166..188 CDD:320499 5/23 (22%)
TM helix 5 214..243 CDD:320499 11/28 (39%)
TM helix 6 253..283 CDD:320499 7/40 (18%)
TM helix 7 303..328 CDD:320499 8/24 (33%)
AkhRNP_995639.1 7tm_1 55..319 CDD:278431 71/292 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.