DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13069 and CG13051

DIOPT Version :9

Sequence 1:NP_652418.1 Gene:CG13069 / 50271 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001097618.1 Gene:CG13051 / 5740583 FlyBaseID:FBgn0040799 Length:83 Species:Drosophila melanogaster


Alignment Length:107 Identity:60/107 - (56%)
Similarity:65/107 - (60%) Gaps:34/107 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFFAVALFALIACVAAKPGIVAPLAYSAPLVAAAPAAAVYSREYHGNFAAPYVASPYVASPYV 65
            ||||.|..:|||.||||||||||||||||                      ||||||||||||||
  Fly     1 MFKFVAAVIFALFACVAAKPGIVAPLAYS----------------------APYVASPYVASPYV 43

  Fly    66 ASPYVASPYV-------ASPYV---ASPYVAAPYTAPLLLKK 97
            ||||||:||.       |:||.   .:||.|  ||:||||||
  Fly    44 ASPYVAAPYTAAYTAAYAAPYTTAYTAPYAA--YTSPLLLKK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 30/49 (61%)
CG13051NP_001097618.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456961
Domainoid 1 1.000 52 1.000 Domainoid score I7659
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007619
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.