DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13069 and CG18294

DIOPT Version :10

Sequence 1:NP_652418.1 Gene:CG13069 / 50271 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_649115.2 Gene:CG18294 / 40115 FlyBaseID:FBgn0036873 Length:141 Species:Drosophila melanogaster


Alignment Length:117 Identity:53/117 - (45%)
Similarity:68/117 - (58%) Gaps:27/117 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFFAVALFALIACVAAKPGIV-------APLAYSAPLVAAAPAAA--------------VYSR 44
            ||| .||.:.|::||.|||||::       |||||||||..:||||.              |.:|
  Fly     1 MFK-SAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIAR 64

  Fly    45 EYHGNFAAPYVASPYVASPYVASPYVASPYVASPYVASPYVAAPYTAPLLLK 96
            .|:|..|||.:|.  ||:|.||. |.|:| :|:|.||. |.|||..||::.|
  Fly    65 NYNGIAAAPVIAP--VAAPVVAK-YAAAP-LAAPVVAK-YAAAPLAAPVVAK 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 19/39 (49%)
CG18294NP_649115.2 None

Return to query results.
Submit another query.