DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13069 and CG12519

DIOPT Version :10

Sequence 1:NP_652418.1 Gene:CG13069 / 50271 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_649114.2 Gene:CG12519 / 40114 FlyBaseID:FBgn0036872 Length:131 Species:Drosophila melanogaster


Alignment Length:114 Identity:52/114 - (45%)
Similarity:65/114 - (57%) Gaps:27/114 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFFAVALFALIACVAAKPGIV-------APLAYSAPLVAAAPAAA--------------VYSR 44
            ||| .||.:.|::||.|||||::       |||||||||..:||||.              |.:|
  Fly     1 MFK-SAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIAR 64

  Fly    45 EYHGNFAAPYVASPYVASPYVASPYVASPYVASPYVASPYVAAPYTAPL 93
            .|:|..|||.:|.  ||:|.||. |.|:| :|:|.||. |.|.|..|||
  Fly    65 NYNGIAAAPVIAP--VAAPVVAK-YAAAP-LAAPVVAK-YAATPLAAPL 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 18/39 (46%)
CG12519NP_649114.2 None

Return to query results.
Submit another query.