DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13069 and CG12519

DIOPT Version :9

Sequence 1:NP_652418.1 Gene:CG13069 / 50271 FlyBaseID:FBgn0040798 Length:97 Species:Drosophila melanogaster
Sequence 2:NP_001262046.1 Gene:CG12519 / 40114 FlyBaseID:FBgn0036872 Length:131 Species:Drosophila melanogaster


Alignment Length:114 Identity:52/114 - (45%)
Similarity:65/114 - (57%) Gaps:27/114 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKFFAVALFALIACVAAKPGIV-------APLAYSAPLVAAAPAAA--------------VYSR 44
            ||| .||.:.|::||.|||||::       |||||||||..:||||.              |.:|
  Fly     1 MFK-SAVVILAIVACAAAKPGLLGAPLAYTAPLAYSAPLAYSAPAAVVAAPAPVVTATSSQVIAR 64

  Fly    45 EYHGNFAAPYVASPYVASPYVASPYVASPYVASPYVASPYVAAPYTAPL 93
            .|:|..|||.:|.  ||:|.||. |.|:| :|:|.||. |.|.|..|||
  Fly    65 NYNGIAAAPVIAP--VAAPVVAK-YAAAP-LAAPVVAK-YAATPLAAPL 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13069NP_652418.1 PTZ00395 <52..>92 CDD:185594 18/39 (46%)
CG12519NP_001262046.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2BWJG
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR35685
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.