DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13066 and LOC5667232

DIOPT Version :10

Sequence 1:NP_652417.2 Gene:CG13066 / 50270 FlyBaseID:FBgn0040797 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_001688037.1 Gene:LOC5667232 / 5667232 VectorBaseID:AGAMI1_005864 Length:145 Species:Anopheles gambiae


Alignment Length:132 Identity:49/132 - (37%)
Similarity:59/132 - (44%) Gaps:47/132 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FAVVLC--AL-FAAAAANPGLLA--------------------------YN--APLAYSTPLAYS 38
            |..::|  || .:.|:|.|||||                          ||  |||||:.|....
Mosquito     2 FTKLICIAALAISCASAKPGLLAPVAAPVAYAAGPAVVTAQSSQVVARNYNGIAPLAYTAPAVAY 66

  Fly    39 SLPA----AAPLAYTA---------AYTPAYAPYVAPYASSYSAHSVAHSAALPAVYAAAPVATI 90
            :.||    ||||||.|         |..|..||||||||:.|:|   .::||..|.||||..|..
Mosquito    67 AAPAVAKVAAPLAYAAPAPLAAAAYAAAPLAAPYVAPYAAPYAA---PYAAAYAAPYAAAYAAPY 128

  Fly    91 LK 92
            .|
Mosquito   129 AK 130

Return to query results.
Submit another query.