powered by:
Protein Alignment CG13056 and retinin
DIOPT Version :9
Sequence 1: | NP_652414.2 |
Gene: | CG13056 / 50267 |
FlyBaseID: | FBgn0040794 |
Length: | 99 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524995.2 |
Gene: | retinin / 53564 |
FlyBaseID: | FBgn0040074 |
Length: | 191 |
Species: | Drosophila melanogaster |
Alignment Length: | 43 |
Identity: | 23/43 - (53%) |
Similarity: | 31/43 - (72%) |
Gaps: | 0/43 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 36 PTFAKVGHLVEHVPTAVSHQSSTIVHRSVPRTTSLLTPALRST 78
|..||||.:|:|||||||||:.|:||......|.::.||:|:|
Fly 125 PAVAKVGEVVQHVPTAVSHQTQTVVHDHRRLVTPIVAPAVRTT 167
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR34931 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.