DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13056 and CG13042

DIOPT Version :10

Sequence 1:NP_652414.2 Gene:CG13056 / 50267 FlyBaseID:FBgn0040794 Length:99 Species:Drosophila melanogaster
Sequence 2:NP_648870.1 Gene:CG13042 / 39798 FlyBaseID:FBgn0036602 Length:117 Species:Drosophila melanogaster


Alignment Length:104 Identity:32/104 - (30%)
Similarity:48/104 - (46%) Gaps:20/104 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RMYLSFALLLCLLA----LGNADLQLYHPLMTLHHPPTFAKVGHLVEHVPTAVSHQSSTIVHRS- 63
            ::.:.||||..:.|    |.:..|...:....:.|.|..||||.:::.||:||||||.:.||.| 
  Fly     3 KLVVFFALLAVVAARPGYLESGPLLHSYAAPAIIHEPALAKVGAIIKTVPSAVSHQSISQVHSSA 67

  Fly    64 ---------------VPRTTSLLTPALRSTYLNYPTWGY 87
                           .|...:...|||.:|.|:.|..|:
  Fly    68 HIIQPIVAPVVKTYAAPIIKTYAAPALHTTLLSSPWAGH 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13056NP_652414.2 Retinin_C 34..83 CDD:427994 23/64 (36%)
CG13042NP_648870.1 Retinin_C 35..93 CDD:427994 18/57 (32%)

Return to query results.
Submit another query.