powered by:
Protein Alignment CG7630 and gom
DIOPT Version :9
Sequence 1: | NP_652413.1 |
Gene: | CG7630 / 50266 |
FlyBaseID: | FBgn0040793 |
Length: | 90 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524659.1 |
Gene: | gom / 43934 |
FlyBaseID: | FBgn0029084 |
Length: | 305 |
Species: | Drosophila melanogaster |
Alignment Length: | 67 |
Identity: | 26/67 - (38%) |
Similarity: | 41/67 - (61%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 21 RAAYHGGHGPHSTMNDLPVPAGDWKEQHSQKNAKYNAALITGILVLAGTIGFVKSSGIIHFNYYA 85
:..|....|.|:.::|.|.|.||:.:..|.||::||..|::|||...||:||..|||::..|:..
Fly 70 KPGYFASGGQHAVLSDCPKPEGDFMKAWSAKNSRYNLILVSGILAAGGTLGFALSSGVLCLNWTI 134
Fly 86 PK 87
|:
Fly 135 PE 136
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0014255 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR22133 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.