DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7B and gom

DIOPT Version :10

Sequence 1:NP_652413.1 Gene:COX7B / 50266 FlyBaseID:FBgn0040793 Length:90 Species:Drosophila melanogaster
Sequence 2:NP_524659.1 Gene:gom / 43934 FlyBaseID:FBgn0029084 Length:305 Species:Drosophila melanogaster


Alignment Length:67 Identity:26/67 - (38%)
Similarity:41/67 - (61%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 RAAYHGGHGPHSTMNDLPVPAGDWKEQHSQKNAKYNAALITGILVLAGTIGFVKSSGIIHFNYYA 85
            :..|....|.|:.::|.|.|.||:.:..|.||::||..|::|||...||:||..|||::..|:..
  Fly    70 KPGYFASGGQHAVLSDCPKPEGDFMKAWSAKNSRYNLILVSGILAAGGTLGFALSSGVLCLNWTI 134

  Fly    86 PK 87
            |:
  Fly   135 PE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7BNP_652413.1 Deltameth_res 35..86 CDD:464978 22/50 (44%)
gomNP_524659.1 Deltameth_res 84..135 CDD:464978 22/50 (44%)
Radial_spoke_3 <202..>243 CDD:461827
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.