powered by:
Protein Alignment CG14104 and Swi5
DIOPT Version :9
Sequence 1: | NP_652408.2 |
Gene: | CG14104 / 50259 |
FlyBaseID: | FBgn0040786 |
Length: | 68 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001277481.1 |
Gene: | Swi5 / 72931 |
MGIID: | 1920181 |
Length: | 121 |
Species: | Mus musculus |
Alignment Length: | 50 |
Identity: | 20/50 - (40%) |
Similarity: | 30/50 - (60%) |
Gaps: | 4/50 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 SEGQK----KKIIELLHEYNDLKDATQRVLEALANLKCVPVGSVYATYNL 64
:||.: :|.|.|||||||:||.:|.:|..||..:.|....:|..::|
Mouse 68 AEGYRVIELEKHISLLHEYNDIKDVSQMLLGKLAVTRGVTTKELYPDFDL 117
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14104 | NP_652408.2 |
Swi5 |
<16..59 |
CDD:284474 |
18/43 (42%) |
Swi5 | NP_001277481.1 |
Swi5 |
47..119 |
CDD:284474 |
19/49 (39%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006013 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_107974 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.810 |
|
Return to query results.
Submit another query.