DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14104 and Swi5

DIOPT Version :9

Sequence 1:NP_652408.2 Gene:CG14104 / 50259 FlyBaseID:FBgn0040786 Length:68 Species:Drosophila melanogaster
Sequence 2:NP_001277481.1 Gene:Swi5 / 72931 MGIID:1920181 Length:121 Species:Mus musculus


Alignment Length:50 Identity:20/50 - (40%)
Similarity:30/50 - (60%) Gaps:4/50 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SEGQK----KKIIELLHEYNDLKDATQRVLEALANLKCVPVGSVYATYNL 64
            :||.:    :|.|.|||||||:||.:|.:|..||..:.|....:|..::|
Mouse    68 AEGYRVIELEKHISLLHEYNDIKDVSQMLLGKLAVTRGVTTKELYPDFDL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14104NP_652408.2 Swi5 <16..59 CDD:284474 18/43 (42%)
Swi5NP_001277481.1 Swi5 47..119 CDD:284474 19/49 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006013
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107974
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.