DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14104 and swi5

DIOPT Version :9

Sequence 1:NP_652408.2 Gene:CG14104 / 50259 FlyBaseID:FBgn0040786 Length:68 Species:Drosophila melanogaster
Sequence 2:XP_012823415.1 Gene:swi5 / 100135158 XenbaseID:XB-GENE-6257718 Length:156 Species:Xenopus tropicalis


Alignment Length:50 Identity:21/50 - (42%)
Similarity:30/50 - (60%) Gaps:4/50 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SEG----QKKKIIELLHEYNDLKDATQRVLEALANLKCVPVGSVYATYNL 64
            |||    :.::.|.||||||:|||..|.:|..||.|:.|....:||.:.:
 Frog   103 SEGFSMAELEEHITLLHEYNELKDVGQMLLGRLAVLRGVTTKELYAEFGM 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14104NP_652408.2 Swi5 <16..59 CDD:284474 19/43 (44%)
swi5XP_012823415.1 Swi5 80..153 CDD:369190 21/49 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1553901at2759
OrthoFinder 1 1.000 - - FOG0006013
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.