DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg10 and ATG10

DIOPT Version :9

Sequence 1:NP_001097215.1 Gene:Atg10 / 50253 FlyBaseID:FBgn0040780 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_001124500.1 Gene:ATG10 / 83734 HGNCID:20315 Length:220 Species:Homo sapiens


Alignment Length:210 Identity:57/210 - (27%)
Similarity:93/210 - (44%) Gaps:62/210 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KDFLSQAKQFLEISQKLGDNWILEQKDSNEPNTYLKCSQKIKCRGGKDNS--------------- 56
            |.|.....:|::.||::||:|  |.:.|.:.:....|....:.:.|...|               
Human    10 KTFQRYCAEFIKHSQQIGDSW--EWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPME 72

  Fly    57 ------------------AELVSVEYHVVFSVSYQVPMLFFQAHRSDGSLLDVEATWRMFMPESK 103
                              :|::..||||::|.|||||:|:|:|...||..|.::..|        
Human    73 EAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIW-------- 129

  Fly   104 ASDLHQ------------ILTQMDHPVLFRPFMALHPCRTAE----VLKQFGK--PSCNQVLTFI 150
             ..:|:            .:||.:||:|.:||..||||:|.|    |||...|  .:.|.:.:::
Human   130 -EGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITSWL 193

  Fly   151 SLYGPHVQLHLQNAY 165
            |:.||.|.|:|..:|
Human   194 SIVGPVVGLNLPLSY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg10NP_001097215.1 Autophagy_act_C 66..130 CDD:281917 25/75 (33%)
ATG10NP_001124500.1 Autophagy_act_C 100..167 CDD:309203 25/75 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11549
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5242
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538225at2759
OrthoFinder 1 1.000 - - FOG0005851
OrthoInspector 1 1.000 - - oto90025
orthoMCL 1 0.900 - - OOG6_104820
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3745
SonicParanoid 1 1.000 - - X6351
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.