DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg10 and ATG10

DIOPT Version :9

Sequence 1:NP_001097215.1 Gene:Atg10 / 50253 FlyBaseID:FBgn0040780 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_850533.1 Gene:ATG10 / 819941 AraportID:AT3G07525 Length:226 Species:Arabidopsis thaliana


Alignment Length:168 Identity:45/168 - (26%)
Similarity:75/168 - (44%) Gaps:43/168 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSQAKQFLEISQKLGDNWILEQKDSNEPNTYLKCSQKIKCRGGKDNSAELVSVEYHVVFSVSYQV 74
            |:.|...|| .::..|:.||.....||.:.|                      ::|:|:|.||:|
plant    80 LNVATDCLE-KEETVDHTILVPTMENEAHYY----------------------DFHIVYSASYKV 121

  Fly    75 PMLFFQAHRSDGSLL-------DVEATWRMFMPESKASDLHQILTQMDHPVLFRPFMALHPCRTA 132
            |:|:|:.:.|.|..|       ||.:.....:.|||.:    .:||.:||.|.||:..||||.|.
plant   122 PVLYFRGYCSGGEPLALDVIKKDVPSCSVSLLLESKWT----FITQEEHPYLNRPWFKLHPCGTE 182

  Fly   133 EVLKQFGKPSCNQ---------VLTFISLYGPHVQLHL 161
            :.:|...:.|.:.         ::::.|:.|..|.|.:
plant   183 DWIKLLSQSSSSSGCQMPIVLYLVSWFSVVGQVVGLRI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg10NP_001097215.1 Autophagy_act_C 66..130 CDD:281917 26/70 (37%)
ATG10NP_850533.1 Autophagy_act_C 17..223 CDD:397886 45/168 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 47 1.000 Domainoid score I4568
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538225at2759
OrthoFinder 1 1.000 - - FOG0005851
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104820
Panther 1 1.100 - - LDO PTHR12866
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6351
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.920

Return to query results.
Submit another query.