DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg10 and Atg10

DIOPT Version :9

Sequence 1:NP_001097215.1 Gene:Atg10 / 50253 FlyBaseID:FBgn0040780 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_080046.3 Gene:Atg10 / 66795 MGIID:1914045 Length:211 Species:Mus musculus


Alignment Length:206 Identity:60/206 - (29%)
Similarity:93/206 - (45%) Gaps:58/206 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KDFLSQAKQFLEISQKLGDNWILEQKDSNEPNTYLKCSQKIK--------------CRGGKDN-- 55
            |.|.....:|:..||::||.|  |.:.:.|.:....|..:.:              |...::|  
Mouse     9 KSFQHYCAEFIRHSQQIGDGW--EWRTAKECSDGYMCKTQFRIKNETLTPHASVLTCLPTEENLE 71

  Fly    56 -------------SAELVSVEYHVVFSVSYQVPMLFFQAHRSDGSLLDVEATWRMFMPESKASDL 107
                         .||::..||||::|.|||||:|:|:|...||..|.:|..|         ..:
Mouse    72 LPMDDSEVTRPAAVAEVIKHEYHVLYSCSYQVPVLYFRASFLDGRPLALEDIW---------EGV 127

  Fly   108 HQ------------ILTQMDHPVLFRPFMALHPCRTAE----VLKQFGK--PSCNQVLTFISLYG 154
            |:            .:||.:||:|.:||..||||:|.|    |||...|  .:.|.:.:::||.|
Mouse   128 HECYKPRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTAVLKNSQKINRNVNYITSWLSLVG 192

  Fly   155 PHVQLHLQNAY 165
            |.|.|:|..:|
Mouse   193 PVVGLNLPLSY 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg10NP_001097215.1 Autophagy_act_C 66..130 CDD:281917 26/75 (35%)
Atg10NP_080046.3 Autophagy_act_C 95..162 CDD:367758 25/84 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11256
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5204
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005851
OrthoInspector 1 1.000 - - oto93602
orthoMCL 1 0.900 - - OOG6_104820
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3745
SonicParanoid 1 1.000 - - X6351
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.