DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg10 and Atg3

DIOPT Version :10

Sequence 1:NP_001097215.1 Gene:Atg10 / 50253 FlyBaseID:FBgn0040780 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_649059.1 Gene:Atg3 / 40044 FlyBaseID:FBgn0036813 Length:330 Species:Drosophila melanogaster


Alignment Length:162 Identity:33/162 - (20%)
Similarity:58/162 - (35%) Gaps:42/162 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IVPNDSAPLWSVIEQFSADRKR----SFRHDRLQRGLCMNRC------------HQLLTRFDPRT 78
            :.|:.|:|..:..:..|...:|    :||...|...:...|.            |.|.:..|..:
  Fly   393 VQPSPSSPALTPYQNNSLHNQRRLSENFRRSLLSSLVTQQRAARSLAHPASPNEHVLQSGGDNTS 457

  Fly    79 QM---KTSILSPR-----TQI---------TFDPNTFRGALDWRN---RYRRLANQCVNYELKRQ 123
            |:   .:|...||     |.|         |....|..||.:.||   ..||..|      |:.:
  Fly   458 QVHNRASSRAGPRQGQDATGISHSLRGLASTSRGRTRMGASEIRNILEHMRRAGN------LRLE 516

  Fly   124 YSLMAYTTVEYCTTNRAQTYRDVRVSAIDVTF 155
            ..::...::.....:....|||:|:...::|:
  Fly   517 DVMLLNQSIMLGAADIHDRYRDMRLDVDNMTY 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg10NP_001097215.1 Autophagy_act_C 8..161 CDD:461120 33/162 (20%)
Atg3NP_649059.1 Autophagy_act_C <210..323 CDD:461120
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.