DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg10 and SPAC227.04

DIOPT Version :9

Sequence 1:NP_001097215.1 Gene:Atg10 / 50253 FlyBaseID:FBgn0040780 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_592958.1 Gene:SPAC227.04 / 2541913 PomBaseID:SPAC227.04 Length:179 Species:Schizosaccharomyces pombe


Alignment Length:148 Identity:36/148 - (24%)
Similarity:60/148 - (40%) Gaps:36/148 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LSQAKQFLEISQKLGD-----------------NWILEQKDSNEPNTYLKCSQKIKCRGGKDNSA 57
            :|...|.|.::|||..                 .|..|..|.|:...|   .|:      :|:..
pombe     1 MSFKSQLLILAQKLSKGGISCELIEFDECILKLEWHTELLDKNDSLLY---EQE------EDDIL 56

  Fly    58 ELVS--VEYH--VVFSVSYQVPMLFFQAHRSDGS--LLDVEATWRMFMPESKASDL-HQILTQMD 115
            .|::  :..|  :..|.|::||..|||.: ::||  |..:|..:.:.  |..:.:| :..|...|
pombe    57 SLMNPMITMHAWIRDSPSFEVPQFFFQPY-ANGSDPLTKMEQIFELL--EGSSQNLAYDALAIGD 118

  Fly   116 HPVLFRPFMALHPCRTAE 133
            .|........:|||||.:
pombe   119 CPGTVGIAWYIHPCRTRD 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg10NP_001097215.1 Autophagy_act_C 66..130 CDD:281917 18/66 (27%)
SPAC227.04NP_592958.1 Autophagy_act_C 69..133 CDD:281917 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104820
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.