DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg10 and atg-10

DIOPT Version :9

Sequence 1:NP_001097215.1 Gene:Atg10 / 50253 FlyBaseID:FBgn0040780 Length:172 Species:Drosophila melanogaster
Sequence 2:NP_495839.2 Gene:atg-10 / 183959 WormBaseID:WBGene00008427 Length:157 Species:Caenorhabditis elegans


Alignment Length:166 Identity:37/166 - (22%)
Similarity:81/166 - (48%) Gaps:23/166 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSWKDFLSQAKQFLEISQKLGDN---WILEQKDSNEPNTYLKCSQKIKCRGGKDNSAELVSVEYH 65
            |:.:.|..:.:.|::   |:.:|   |.|::.......|:||..          :...:::.|.|
 Worm     2 LTEQQFRDEIRGFVD---KMNENNFHWQLKEIGKYARETHLKTL----------SDGRVITSETH 53

  Fly    66 VVFSVSYQVPMLFFQAHRSDGSLLDVEATWRMFM-----PESKASDLHQILTQMDHPVLFRPFMA 125
            ::::.:||||.::|....::||.|......|..:     .||:|| :...::..:||.:...:..
 Worm    54 ILYNSTYQVPTIWFNFFENNGSPLPFRTVIRDVLNISETEESEAS-IRSRISHYEHPFMGVLYYN 117

  Fly   126 LHPCRTAEVLKQFGKPSCNQVLTFISLYGPHVQLHL 161
            :|||.|:.::|:..... :.::::.|:||..:.|.|
 Worm   118 IHPCNTSNIMKELNTDR-SYLMSWFSVYGQQIGLKL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg10NP_001097215.1 Autophagy_act_C 66..130 CDD:281917 17/68 (25%)
atg-10NP_495839.2 Autophagy_act_C 54..122 CDD:367758 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4086
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1538225at2759
OrthoFinder 1 1.000 - - FOG0005851
OrthoInspector 1 1.000 - - oto17450
orthoMCL 1 0.900 - - OOG6_104820
Panther 1 1.100 - - LDO PTHR12866
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3745
SonicParanoid 1 1.000 - - X6351
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.000

Return to query results.
Submit another query.