DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30377 and Cdk2ap1

DIOPT Version :9

Sequence 1:NP_001286171.1 Gene:CG30377 / 50252 FlyBaseID:FBgn0050377 Length:897 Species:Drosophila melanogaster
Sequence 2:XP_038945523.1 Gene:Cdk2ap1 / 360804 RGDID:1308664 Length:180 Species:Rattus norvegicus


Alignment Length:88 Identity:25/88 - (28%)
Similarity:36/88 - (40%) Gaps:14/88 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   773 GNKAERDRERESLAEWHRKKPSIWEMYYGTNRLHQ--SLLGKQ-RGGGELVISSAQPTLSYPSSR 834
            |.:...:|:|.:||...|:    ||......|:.|  .|.|.. |.|||......|       .|
  Rat    31 GLRRSLERQRNALAMRRRR----WEKREARRRMCQEAELQGLACRPGGEAWEWRQQ-------RR 84

  Fly   835 PESDFTLDLPRAEQLRLKMEKEK 857
            .|....||...|..::|:.|:|:
  Rat    85 EEQAKALDRELATMVQLRQEEER 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30377NP_001286171.1 None
Cdk2ap1XP_038945523.1 CDK2AP <127..179 CDD:370710
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.