DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30377 and Cdk2ap1

DIOPT Version :9

Sequence 1:NP_001286171.1 Gene:CG30377 / 50252 FlyBaseID:FBgn0050377 Length:897 Species:Drosophila melanogaster
Sequence 2:NP_038840.2 Gene:Cdk2ap1 / 13445 MGIID:1202069 Length:114 Species:Mus musculus


Alignment Length:115 Identity:27/115 - (23%)
Similarity:40/115 - (34%) Gaps:43/115 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   746 NLTFHKPILAVSNSNPGGGNVTVDGAGGNKAERDRERESLAEWHRKKPSIWEMYYGTNRLHQSLL 810
            |||.|.|..|:   |.|    :|.....:.|...:.|:.|:::  ..||               |
Mouse     6 NLTAHMPAAAL---NAG----SVHSPSTSMATSSQYRQLLSDY--GPPS---------------L 46

  Fly   811 GKQRGGGELVISSAQPTLSYPSSRPESDFTLDLPRAEQLRLKMEKEKKFR 860
            |..:|.|.             |..|:|.:      ||.|.:..|..|:.|
Mouse    47 GYTQGTGN-------------SQVPQSKY------AELLAIIEELGKEIR 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30377NP_001286171.1 None
Cdk2ap1NP_038840.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..57 12/72 (17%)
Interaction with CDK2AP2. /evidence=ECO:0000250|UniProtKB:O14519 19..24 2/8 (25%)
CDK2AP <61..113 CDD:370710 6/23 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.