powered by:
Protein Alignment COX7C and COX8
DIOPT Version :9
Sequence 1: | NP_001286268.1 |
Gene: | COX7C / 50246 |
FlyBaseID: | FBgn0040773 |
Length: | 66 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013499.1 |
Gene: | COX8 / 851111 |
SGDID: | S000004387 |
Length: | 78 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 39 |
Identity: | 14/39 - (35%) |
Similarity: | 19/39 - (48%) |
Gaps: | 1/39 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 ENLPFGLTNKYRITALFTIG-CVLGFGSPFLIVRHQLLK 65
||:||.:..:....||...| ..:||..||:....||.|
Yeast 36 ENIPFKVKGRKTPYALSHFGFFAIGFAVPFVACYVQLKK 74
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4527 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR13313 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.000 |
|
Return to query results.
Submit another query.