DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7C and cox8

DIOPT Version :9

Sequence 1:NP_001286268.1 Gene:COX7C / 50246 FlyBaseID:FBgn0040773 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_594028.1 Gene:cox8 / 2542644 PomBaseID:SPAC24C9.16c Length:66 Species:Schizosaccharomyces pombe


Alignment Length:62 Identity:21/62 - (33%)
Similarity:32/62 - (51%) Gaps:7/62 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RSSVIARNFSQSMVRFSGHGGV--PGENLPFGLTNKYRITALF--TIGCVLGFGSPFLIVRH 61
            |.|:.||:..:. ||||.....  ||..:||.:..|...|.|:  |.|.:  |..||::|::
pombe     3 RYSLQARSALRG-VRFSSSHSAPKPGSTIPFYINKKPLPTLLYFGTFGVI--FSIPFIVVKY 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7CNP_001286268.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 14/46 (30%)
cox8NP_594028.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 13/44 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13313
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.