powered by:
Protein Alignment COX7C and cox8
DIOPT Version :9
Sequence 1: | NP_001286268.1 |
Gene: | COX7C / 50246 |
FlyBaseID: | FBgn0040773 |
Length: | 66 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_594028.1 |
Gene: | cox8 / 2542644 |
PomBaseID: | SPAC24C9.16c |
Length: | 66 |
Species: | Schizosaccharomyces pombe |
Alignment Length: | 62 |
Identity: | 21/62 - (33%) |
Similarity: | 32/62 - (51%) |
Gaps: | 7/62 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 RSSVIARNFSQSMVRFSGHGGV--PGENLPFGLTNKYRITALF--TIGCVLGFGSPFLIVRH 61
|.|:.||:..:. ||||..... ||..:||.:..|...|.|: |.|.: |..||::|::
pombe 3 RYSLQARSALRG-VRFSSSHSAPKPGSTIPFYINKKPLPTLLYFGTFGVI--FSIPFIVVKY 61
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR13313 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.