DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7C and cox8

DIOPT Version :10

Sequence 1:NP_652397.1 Gene:COX7C / 50246 FlyBaseID:FBgn0040773 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_594028.1 Gene:cox8 / 2542644 PomBaseID:SPAC24C9.16C Length:66 Species:Schizosaccharomyces pombe


Alignment Length:62 Identity:21/62 - (33%)
Similarity:32/62 - (51%) Gaps:7/62 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RSSVIARNFSQSMVRFSGHGGV--PGENLPFGLTNKYRITALF--TIGCVLGFGSPFLIVRH 61
            |.|:.||:..:. ||||.....  ||..:||.:..|...|.|:  |.|.:  |..||::|::
pombe     3 RYSLQARSALRG-VRFSSSHSAPKPGSTIPFYINKKPLPTLLYFGTFGVI--FSIPFIVVKY 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7CNP_652397.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 14/46 (30%)
cox8NP_594028.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 13/44 (30%)

Return to query results.
Submit another query.