DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7C and CG44296

DIOPT Version :9

Sequence 1:NP_001286268.1 Gene:COX7C / 50246 FlyBaseID:FBgn0040773 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_001286270.1 Gene:CG44296 / 19835750 FlyBaseID:FBgn0265342 Length:76 Species:Drosophila melanogaster


Alignment Length:56 Identity:29/56 - (51%)
Similarity:41/56 - (73%) Gaps:2/56 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FSQSMVRF-SGH-GGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
            ||..::|: ||: ||.||.||||||.:..|.|..:.|..|:|||:|||::|||:|:
  Fly    12 FSGPLMRYGSGYPGGSPGANLPFGLDSPMRFTLFYLIAGVVGFGAPFLVIRHQMLR 67

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7CNP_001286268.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 25/45 (56%)
CG44296NP_001286270.1 COX7C <30..67 CDD:281002 19/36 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I11493
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5442
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1642074at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13313
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5025
66.070

Return to query results.
Submit another query.