powered by:
Protein Alignment COX7C and CG44296
DIOPT Version :9
Sequence 1: | NP_001286268.1 |
Gene: | COX7C / 50246 |
FlyBaseID: | FBgn0040773 |
Length: | 66 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001286270.1 |
Gene: | CG44296 / 19835750 |
FlyBaseID: | FBgn0265342 |
Length: | 76 |
Species: | Drosophila melanogaster |
Alignment Length: | 56 |
Identity: | 29/56 - (51%) |
Similarity: | 41/56 - (73%) |
Gaps: | 2/56 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 FSQSMVRF-SGH-GGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
||..::|: ||: ||.||.||||||.:..|.|..:.|..|:|||:|||::|||:|:
Fly 12 FSGPLMRYGSGYPGGSPGANLPFGLDSPMRFTLFYLIAGVVGFGAPFLVIRHQMLR 67
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
52 |
1.000 |
Domainoid score |
I11493 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
54 |
1.000 |
Inparanoid score |
I5442 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1642074at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR13313 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5025 |
|
6 | 6.070 |
|
Return to query results.
Submit another query.