Sequence 1: | NP_001286268.1 | Gene: | COX7C / 50246 | FlyBaseID: | FBgn0040773 | Length: | 66 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001858.1 | Gene: | COX7C / 1350 | HGNCID: | 2292 | Length: | 63 | Species: | Homo sapiens |
Alignment Length: | 65 | Identity: | 30/65 - (46%) |
---|---|---|---|
Similarity: | 41/65 - (63%) | Gaps: | 3/65 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
Fly 66 65 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
COX7C | NP_001286268.1 | Cyt_c_Oxidase_VIIc | 20..65 | CDD:238469 | 19/44 (43%) |
COX7C | NP_001858.1 | Cyt_c_Oxidase_VIIc | 17..62 | CDD:238469 | 18/44 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165148027 | |
Domainoid | 1 | 1.000 | 52 | 1.000 | Domainoid score | I11493 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 54 | 1.000 | Inparanoid score | I5442 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG46321 | |
OrthoDB | 1 | 1.010 | - | - | D1642074at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0006931 | |
OrthoInspector | 1 | 1.000 | - | - | oto91011 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_106540 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR13313 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5099 |
SonicParanoid | 1 | 1.000 | - | - | X5025 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
14 | 13.900 |