DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7C and COX7C

DIOPT Version :9

Sequence 1:NP_001286268.1 Gene:COX7C / 50246 FlyBaseID:FBgn0040773 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_001858.1 Gene:COX7C / 1350 HGNCID:2292 Length:63 Species:Homo sapiens


Alignment Length:65 Identity:30/65 - (46%)
Similarity:41/65 - (63%) Gaps:3/65 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
            |||:|   .|.|:.|:||.|.:...||:||||.:.||:.:.|...:.....|.:|||:|||||||
Human     1 MLGQS---IRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLLK 62

  Fly    66  65
            Human    63  62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7CNP_001286268.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 19/44 (43%)
COX7CNP_001858.1 Cyt_c_Oxidase_VIIc 17..62 CDD:238469 18/44 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148027
Domainoid 1 1.000 52 1.000 Domainoid score I11493
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I5442
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46321
OrthoDB 1 1.010 - - D1642074at2759
OrthoFinder 1 1.000 - - FOG0006931
OrthoInspector 1 1.000 - - oto91011
orthoMCL 1 0.900 - - OOG6_106540
Panther 1 1.100 - - LDO PTHR13313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5099
SonicParanoid 1 1.000 - - X5025
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.