DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7C and cox7c

DIOPT Version :9

Sequence 1:NP_001286268.1 Gene:COX7C / 50246 FlyBaseID:FBgn0040773 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_001165232.1 Gene:cox7c / 100329161 XenbaseID:XB-GENE-965101 Length:63 Species:Xenopus tropicalis


Alignment Length:66 Identity:30/66 - (45%)
Similarity:42/66 - (63%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
            |.|::   .|.|:.|.:|.|.:...||:||||.:.||:|:..:.|:....||..||:||||||||
 Frog     1 MFGQA---VRRFATSAIRRSHYEEGPGKNLPFSVENKWRLLGMMTLFFGSGFAFPFVIVRHQLLK 62

  Fly    66 K 66
            |
 Frog    63 K 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7CNP_001286268.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 21/44 (48%)
cox7cNP_001165232.1 Cyt_c_Oxidase_VIIc 17..62 CDD:238469 21/44 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10880
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5237
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1642074at2759
OrthoFinder 1 1.000 - - FOG0006931
OrthoInspector 1 1.000 - - oto104794
Panther 1 1.100 - - LDO PTHR13313
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5099
SonicParanoid 1 1.000 - - X5025
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.