powered by:
Protein Alignment COX7C and cox7c
DIOPT Version :9
Sequence 1: | NP_001286268.1 |
Gene: | COX7C / 50246 |
FlyBaseID: | FBgn0040773 |
Length: | 66 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001165232.1 |
Gene: | cox7c / 100329161 |
XenbaseID: | XB-GENE-965101 |
Length: | 63 |
Species: | Xenopus tropicalis |
Alignment Length: | 66 |
Identity: | 30/66 - (45%) |
Similarity: | 42/66 - (63%) |
Gaps: | 3/66 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
|.|:: .|.|:.|.:|.|.:...||:||||.:.||:|:..:.|:....||..||:||||||||
Frog 1 MFGQA---VRRFATSAIRRSHYEEGPGKNLPFSVENKWRLLGMMTLFFGSGFAFPFVIVRHQLLK 62
Fly 66 K 66
|
Frog 63 K 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
56 |
1.000 |
Domainoid score |
I10880 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
58 |
1.000 |
Inparanoid score |
I5237 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1642074at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006931 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto104794 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR13313 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R5099 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X5025 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
10 | 10.100 |
|
Return to query results.
Submit another query.