DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment COX7C and Cox7c

DIOPT Version :9

Sequence 1:NP_001286268.1 Gene:COX7C / 50246 FlyBaseID:FBgn0040773 Length:66 Species:Drosophila melanogaster
Sequence 2:NP_001128177.1 Gene:Cox7c / 100188937 RGDID:2300145 Length:63 Species:Rattus norvegicus


Alignment Length:66 Identity:33/66 - (50%)
Similarity:44/66 - (66%) Gaps:3/66 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVRHQLLK 65
            |||:|   .|.|:.|:||.|.:...||:||||.:.||:|:..:.|:....||.:||.||||||||
  Rat     1 MLGQS---IRRFTTSVVRRSHYEEGPGKNLPFSVENKWRLLLMMTVYFGSGFAAPFFIVRHQLLK 62

  Fly    66 K 66
            |
  Rat    63 K 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
COX7CNP_001286268.1 Cyt_c_Oxidase_VIIc 20..65 CDD:238469 21/44 (48%)
Cox7cNP_001128177.1 Cyt_c_Oxidase_VIIc 17..62 CDD:238469 21/44 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341901
Domainoid 1 1.000 58 1.000 Domainoid score I10564
eggNOG 1 0.900 - - E1_KOG4527
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5290
OMA 1 1.010 - - QHG46321
OrthoDB 1 1.010 - - D1642074at2759
OrthoFinder 1 1.000 - - FOG0006931
OrthoInspector 1 1.000 - - oto98107
orthoMCL 1 0.900 - - OOG6_106540
Panther 1 1.100 - - LDO PTHR13313
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5025
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.