DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18336 and CG18335

DIOPT Version :9

Sequence 1:NP_001260888.1 Gene:CG18336 / 50236 FlyBaseID:FBgn0040763 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_610666.1 Gene:CG18335 / 36202 FlyBaseID:FBgn0033610 Length:323 Species:Drosophila melanogaster


Alignment Length:107 Identity:28/107 - (26%)
Similarity:45/107 - (42%) Gaps:28/107 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 GFDFHLP--------------DEGWCYPKNDMHFIRSAEWVPVEKAGVGRSFANP--------NG 50
            |:..|:|              :...|...:.|:..:...|.      .|:..:.|        :.
  Fly   207 GYSGHIPMSVTRFGESNKVLTNRALCSFSDYMYKRKRDTWC------CGQDLSRPSITCPPVGHF 265

  Fly    51 VIYPRVVGMIPRYGGHVPGNKFRVGNTYGRSTIDAKRHLALN 92
            |:|....||:|.|.|||||..::.|.||.::|.||||.|.::
  Fly   266 VVYHEDSGMVPNYAGHVPGETYKFGRTYAKTTYDAKRWLEVH 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18336NP_001260888.1 DUF2475 58..>82 CDD:402320 12/23 (52%)
CG18335NP_610666.1 DUF2475 8..>41 CDD:287584
DUF2475 271..>297 CDD:287584 12/25 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D497432at33208
OrthoFinder 1 1.000 - - FOG0008107
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.