DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18336 and Cimip2b

DIOPT Version :10

Sequence 1:NP_652387.1 Gene:CG18336 / 50236 FlyBaseID:FBgn0040763 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_796351.2 Gene:Cimip2b / 329831 MGIID:2445194 Length:379 Species:Mus musculus


Alignment Length:41 Identity:16/41 - (39%)
Similarity:20/41 - (48%) Gaps:9/41 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GRSFANPNGVIYPRVVGMIPRYGGHVPGNKFRVGNTYGRST 82
            |.|..||:         .||.|.||.|..:|.:|.|||:.|
Mouse    10 GLSGENPH---------YIPGYTGHCPLLRFSMGQTYGQVT 41

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18336NP_652387.1 DUF2475 58..>82 CDD:431404 11/23 (48%)
Cimip2bNP_796351.2 DUF2475 16..>85 CDD:431404 13/35 (37%)

Return to query results.
Submit another query.