DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18336 and Cimip2b

DIOPT Version :10

Sequence 1:NP_652387.1 Gene:CG18336 / 50236 FlyBaseID:FBgn0040763 Length:94 Species:Drosophila melanogaster
Sequence 2:XP_063144599.1 Gene:Cimip2b / 100365928 RGDID:2318060 Length:374 Species:Rattus norvegicus


Alignment Length:41 Identity:17/41 - (41%)
Similarity:20/41 - (48%) Gaps:9/41 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 GRSFANPNGVIYPRVVGMIPRYGGHVPGNKFRVGNTYGRST 82
            |.|..||:         .||.|.||.|..:|.||.|||:.|
  Rat   101 GLSPQNPH---------YIPGYTGHCPLLRFSVGQTYGQVT 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18336NP_652387.1 DUF2475 58..>82 CDD:431404 12/23 (52%)
Cimip2bXP_063144599.1 None

Return to query results.
Submit another query.