DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18336 and cimip2b

DIOPT Version :10

Sequence 1:NP_652387.1 Gene:CG18336 / 50236 FlyBaseID:FBgn0040763 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001106452.1 Gene:cimip2b / 100127629 XenbaseID:XB-GENE-6456701 Length:306 Species:Xenopus tropicalis


Alignment Length:64 Identity:27/64 - (42%)
Similarity:35/64 - (54%) Gaps:10/64 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EKAGV---------GRSFANPNGVIYPRVVGMIPRYGGHVPGNKFRVGNTYGRSTIDAKRHLAL 91
            :|.||         |.....| |.||...:|::|||.|:|||.||:.|||:||.|.:|..|..|
 Frog   238 QKKGVRFSEGYKEGGSPHTEP-GQIYLEELGLLPRYTGYVPGYKFQFGNTFGRLTQNALGHSTL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18336NP_652387.1 DUF2475 58..>82 CDD:431404 15/23 (65%)
cimip2bNP_001106452.1 DUF2475 17..>57 CDD:431404
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 61..92
DUF2475 265..>292 CDD:431404 15/26 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.