DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17059 and cops9

DIOPT Version :10

Sequence 1:NP_652383.1 Gene:CG17059 / 50227 FlyBaseID:FBgn0040754 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_957141.2 Gene:cops9 / 393820 ZFINID:ZDB-GENE-040426-1883 Length:57 Species:Danio rerio


Alignment Length:58 Identity:34/58 - (58%)
Similarity:49/58 - (84%) Gaps:4/58 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 MKPSLAADEMFSEGPG-YMEMDESGGATGMMMDHLPSNDKHVHADFYNDFDDLFDEDN 61
            |||  |.||||.||.| |:::||:||::|::|| |.:|:|.||:||:|||:||||:|:
Zfish     1 MKP--AVDEMFPEGAGPYVDLDEAGGSSGLLMD-LAANEKAVHSDFFNDFEDLFDDDD 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17059NP_652383.1 MYEOV2 5..61 CDD:464436 33/56 (59%)
cops9NP_957141.2 MYEOV2 1..50 CDD:464436 29/51 (57%)

Return to query results.
Submit another query.