DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BomS5 and BomS2

DIOPT Version :10

Sequence 1:NP_652366.1 Gene:BomS5 / 50207 FlyBaseID:FBgn0040734 Length:40 Species:Drosophila melanogaster
Sequence 2:NP_725776.1 Gene:BomS2 / 49802 FlyBaseID:FBgn0025583 Length:45 Species:Drosophila melanogaster


Alignment Length:44 Identity:27/44 - (61%)
Similarity:35/44 - (79%) Gaps:4/44 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKWMSL--VFLCGLLAMAVASPL--NPGNVIINGDCRHCNVRGG 40
            ||:.|:  ||:.||||:|.|.||  :||||:|||||::|||.||
  Fly     1 MKFFSVVTVFVFGLLALANAVPLSPDPGNVVINGDCKYCNVHGG 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BomS5NP_652366.1 DIM 1..36 CDD:400485 22/38 (58%)
BomS2NP_725776.1 DIM <13..40 CDD:400485 17/26 (65%)

Return to query results.
Submit another query.