powered by:
Protein Alignment ND-B8 and MRPL51
DIOPT Version :9
Sequence 1: | NP_652341.1 |
Gene: | ND-B8 / 50178 |
FlyBaseID: | FBgn0040705 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_015425.1 |
Gene: | MRPL51 / 856214 |
SGDID: | S000006304 |
Length: | 140 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 69 |
Identity: | 19/69 - (27%) |
Similarity: | 33/69 - (47%) |
Gaps: | 6/69 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 26 GDTSKGVREYVERFYPNLKKSNPDLPIL---VRECSGVQPRLYARYGNGKEVSLSLANHAAPDIH 87
|.:|:|:|:::.. ..|.|...:.|.: |...|| .|.|.|.|.||:|..:.:.|....::.
Yeast 34 GGSSEGMRKFLTS--KRLDKWGQEFPWIQFEVMRKSG-HPLLRAEYTNGREKVICVRNLNIDNVE 95
Fly 88 KNLE 91
..|:
Yeast 96 NKLK 99
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
2 | 1.870 |
|
Return to query results.
Submit another query.