DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B8 and MRPL51

DIOPT Version :9

Sequence 1:NP_652341.1 Gene:ND-B8 / 50178 FlyBaseID:FBgn0040705 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_015425.1 Gene:MRPL51 / 856214 SGDID:S000006304 Length:140 Species:Saccharomyces cerevisiae


Alignment Length:69 Identity:19/69 - (27%)
Similarity:33/69 - (47%) Gaps:6/69 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GDTSKGVREYVERFYPNLKKSNPDLPIL---VRECSGVQPRLYARYGNGKEVSLSLANHAAPDIH 87
            |.:|:|:|:::..  ..|.|...:.|.:   |...|| .|.|.|.|.||:|..:.:.|....::.
Yeast    34 GGSSEGMRKFLTS--KRLDKWGQEFPWIQFEVMRKSG-HPLLRAEYTNGREKVICVRNLNIDNVE 95

  Fly    88 KNLE 91
            ..|:
Yeast    96 NKLK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B8NP_652341.1 L51_S25_CI-B8 29..93 CDD:197984 18/66 (27%)
MRPL51NP_015425.1 L51_S25_CI-B8 35..104 CDD:197984 18/68 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.