DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B8 and AT5G47890

DIOPT Version :10

Sequence 1:NP_652341.1 Gene:ND-B8 / 50178 FlyBaseID:FBgn0040705 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_199600.1 Gene:AT5G47890 / 834840 AraportID:AT5G47890 Length:97 Species:Arabidopsis thaliana


Alignment Length:86 Identity:40/86 - (46%)
Similarity:53/86 - (61%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SFTPKLKELRIILDPKGDTSKGVREYVERFYPNLKKSNPDLPILVRECSGVQPRLYARYGNGKEV 74
            |.:..:|||||:|......|...|.:||:.|.:||..||.||||:||||||||:::|||..|.|.
plant     6 SISKSMKELRILLCQSSPASAPTRTFVEKNYKDLKSLNPKLPILIRECSGVQPQMWARYDMGVER 70

  Fly    75 SLSLANHAAPDIHKNLEAVGK 95
            .::|.....|.|.|.||.:.|
plant    71 CVNLDGLTEPQILKALENLVK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B8NP_652341.1 L51_S25_CI-B8 29..93 CDD:197984 32/63 (51%)
AT5G47890NP_199600.1 L51_S25_CI-B8 23..92 CDD:197984 33/69 (48%)

Return to query results.
Submit another query.