DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B8 and AT5G47890

DIOPT Version :9

Sequence 1:NP_652341.1 Gene:ND-B8 / 50178 FlyBaseID:FBgn0040705 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_199600.1 Gene:AT5G47890 / 834840 AraportID:AT5G47890 Length:97 Species:Arabidopsis thaliana


Alignment Length:86 Identity:40/86 - (46%)
Similarity:53/86 - (61%) Gaps:0/86 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SFTPKLKELRIILDPKGDTSKGVREYVERFYPNLKKSNPDLPILVRECSGVQPRLYARYGNGKEV 74
            |.:..:|||||:|......|...|.:||:.|.:||..||.||||:||||||||:::|||..|.|.
plant     6 SISKSMKELRILLCQSSPASAPTRTFVEKNYKDLKSLNPKLPILIRECSGVQPQMWARYDMGVER 70

  Fly    75 SLSLANHAAPDIHKNLEAVGK 95
            .::|.....|.|.|.||.:.|
plant    71 CVNLDGLTEPQILKALENLVK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B8NP_652341.1 L51_S25_CI-B8 29..93 CDD:197984 32/63 (51%)
AT5G47890NP_199600.1 L51_S25_CI-B8 23..92 CDD:197984 33/69 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 57 1.000 Domainoid score I4021
eggNOG 1 0.900 - - E1_KOG3446
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37628
Inparanoid 1 1.050 74 1.000 Inparanoid score I2425
OMA 1 1.010 - - QHG54875
OrthoDB 1 1.010 - - D1633416at2759
OrthoFinder 1 1.000 - - FOG0003685
OrthoInspector 1 1.000 - - oto3121
orthoMCL 1 0.900 - - OOG6_103777
Panther 1 1.100 - - LDO PTHR12878
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2554
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.