DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B8 and NDUFA2

DIOPT Version :9

Sequence 1:NP_652341.1 Gene:ND-B8 / 50178 FlyBaseID:FBgn0040705 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_002479.1 Gene:NDUFA2 / 4695 HGNCID:7685 Length:99 Species:Homo sapiens


Alignment Length:83 Identity:42/83 - (50%)
Similarity:60/83 - (72%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LKELRIILDPKGDTSKGVREYVERFYPNLKKSNPDLPILVRECSGVQPRLYARYGNGKEVSLSLA 79
            |:|:||.|..:...|:|||:::|:.|..|||:|||||||:||||.|||:|:|||..|:|.::.|.
Human    16 LREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLN 80

  Fly    80 NHAAPDIHKNLEAV--GK 95
            |.:|..:.:.||.|  ||
Human    81 NFSADQVTRALENVLSGK 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B8NP_652341.1 L51_S25_CI-B8 29..93 CDD:197984 34/63 (54%)
NDUFA2NP_002479.1 L51_S25_CI-B8 28..97 CDD:197984 35/68 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147292
Domainoid 1 1.000 67 1.000 Domainoid score I9861
eggNOG 1 0.900 - - E1_KOG3446
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37628
Inparanoid 1 1.050 84 1.000 Inparanoid score I5183
Isobase 1 0.950 - 0 Normalized mean entropy S3381
OMA 1 1.010 - - QHG54875
OrthoDB 1 1.010 - - D1633416at2759
OrthoFinder 1 1.000 - - FOG0003685
OrthoInspector 1 1.000 - - oto88375
orthoMCL 1 0.900 - - OOG6_103777
Panther 1 1.100 - - LDO PTHR12878
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4437
SonicParanoid 1 1.000 - - X2554
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.