DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B8 and Ndufa2

DIOPT Version :9

Sequence 1:NP_652341.1 Gene:ND-B8 / 50178 FlyBaseID:FBgn0040705 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_001099623.1 Gene:Ndufa2 / 291660 RGDID:1309997 Length:97 Species:Rattus norvegicus


Alignment Length:83 Identity:41/83 - (49%)
Similarity:62/83 - (74%) Gaps:2/83 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LKELRIILDPKGDTSKGVREYVERFYPNLKKSNPDLPILVRECSGVQPRLYARYGNGKEVSLSLA 79
            |:|:||.|..:...|:|||:::::.|..|||::||||||:||||.|||:|:|||..|:|.::||.
  Rat    14 LREIRIHLCQRSPGSQGVRDFIQQRYVELKKAHPDLPILIRECSEVQPKLWARYAFGQEKNVSLN 78

  Fly    80 NHAAPDIHKNLEAV--GK 95
            |.:|.::.|.:|.|  ||
  Rat    79 NLSAAEVTKAMENVLSGK 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B8NP_652341.1 L51_S25_CI-B8 29..93 CDD:197984 33/63 (52%)
Ndufa2NP_001099623.1 L51_S25_CI-B8 26..95 CDD:197984 34/68 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340941
Domainoid 1 1.000 64 1.000 Domainoid score I9892
eggNOG 1 0.900 - - E1_KOG3446
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37628
Inparanoid 1 1.050 82 1.000 Inparanoid score I5102
OMA 1 1.010 - - QHG54875
OrthoDB 1 1.010 - - D1633416at2759
OrthoFinder 1 1.000 - - FOG0003685
OrthoInspector 1 1.000 - - otm44423
orthoMCL 1 0.900 - - OOG6_103777
Panther 1 1.100 - - LDO PTHR12878
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2554
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.